Accession | Q40700 | ||||
---|---|---|---|---|---|
Species | Oryza sativa [ GR_tax:013681 ] | ||||
Name | MADS-box transcription factor 1 | ||||
Symbol | MADS1 | ||||
Synonyms (3) |
|
||||
E.C. Numbers (0) | None | ||||
Gene Names (1) | MADS1 (MADS1) | ||||
Organelle | Not available | ||||
Best Hits To TIGR Rice Gene Models (0) | None [ Click here to generate a BLASTP query ] | ||||
IRGSP/RAP Genes (0) | None | ||||
Source | SWISSPROT | ||||
GenBank Accessions (1) | AAA66187 | ||||
UniProt Accession (Sequence) | Q40700 | ||||
Cultivar | None. | ||||
Comment | OsMADS1 encodes a rice MADS-box protein, it is preferentially expressed in flowers. Ectopic expression of wild-type OsMADS1 in rice results in early flowering and overgrowth of glumes that resemble lemma and palea. Transgenic plants expressing OsMADS1 containing missense mutations in the MADS box exhibited leafy lemma/palea, open hull, reduced stamen numbers and an increase in the number of carpels. The knockdown of OsMADS1 interfered the differentiation of specific cell types in the lemma and palea and displayed the overdeveloped lemma and palea. Leafy hull sterile 1 (lhs1) and naked seed rice (nsr) are homeotic mutations of OsMADS1. OsMADS1 acts as a repressor to control and specify development of lemma and palea. OsMADS1 may interact with the K-box of OsMADS6, OsMADS14 and OsMADS15. (Imported from Gene GR:0080015) |
Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane   -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
Others : Fungi | Metazoa |
3D protein structures : BLink from NCBI |
Pfam (Info) | PF01486; K-box | All Members of this Family | |
---|---|---|---|
PF00319; SRF-TF | All Members of this Family | ||
Prosite (Info) | PS00350; MADS_BOX_1 | Residues from 3: RGKVELKRIENKISRQVTFAKRRNGLLKKAYELSLLCDAEVALIIFSGRGRLFEF All Members of this Family |
|
PS50066; MADS_BOX_2 | Sequence info. not available All Members of this Family |
||
PS51297; K_BOX | Sequence info. not available All Members of this Family |
||
Physio-chemical features | Q40700 | ||
ProtoMap (Info) | MADS1_ORYSA |