![[Home Page]](/images/icons/gramene_logo180new.jpg "[Home Page]"){kind=icon}
Protein Home |
Advanced Search |
Search by Pfam or PROSITE |
Browse by GO Slim |
Documents |
Tutorial |
FAQ |
Help
Oryza sativa (japonica cultivar-group) protein "Q9LST4" (Beta 7 subunit of 20S proteasome) | Accession | Q9LST4 |
|---|---|
| Species | Oryza sativa (japonica cultivar-group) [ GR_tax:013684 ] |
| Name | Beta 7 subunit of 20S proteasome |
| Symbol | OsPBG1 |
| Synonyms (0) | |
| E.C. Numbers (0) | None |
| Gene Names (1) | OsPbG1 |
| Organelle | Not available |
| Best Hits To TIGR Rice Gene Models (0) | None [ Click here to generate a BLASTP query ] |
| IRGSP/RAP Genes (1) | Os09g0515200 |
| Source | TREMBL |
| GenBank Accessions (1) | BAA96839 |
| UniProt Accession (Sequence) | Q9LST4 |
| Cultivar | Nipponbare ( GRIN , IRIS ) |
Associated Ontologies (2) | Term Type | Term | Reference | Evidence | |||
|---|---|---|---|---|---|---|
| Biological Process | ubiquitin-dependent protein catabolic process (GO:0006511) | Jaiswal-P et al., 2003 |
| |||
| Cellular Component | proteasome core complex (GO:0005839) | Jaiswal-P et al., 2003 |
|
Keywords (3) Similarity to Other Proteins (22) | Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
| Others : Fungi | Metazoa |
| 3D protein structures : BLink from NCBI |
Protein Features (4) | Pfam (Info) | PF00227; proteasome | All Members of this Family | |
|---|---|---|---|
| Prosite (Info) | PS00854; PROTEASOME_B | Residues from 41: IALKYKDGVIMASDTGASYGSTLRYKSVERIKAVGKHSLIGASGEFSD All Members of this Family |
|
| Physio-chemical features | Q9LST4 | ||
| ProtoMap (Info) | Q9LST4_ORYSA | ||
Database Cross-References (3) 
