Accession | Q9LST4 |
---|---|
Species | Oryza sativa (japonica cultivar-group) [ GR_tax:013684 ] |
Name | Beta 7 subunit of 20S proteasome |
Symbol | OsPBG1 |
Synonyms (0) | |
E.C. Numbers (0) | None |
Gene Names (1) | OsPbG1 |
Organelle | Not available |
Best Hits To TIGR Rice Gene Models (0) | None [ Click here to generate a BLASTP query ] |
IRGSP/RAP Genes (1) | Os09g0515200 |
Source | TREMBL |
GenBank Accessions (1) | BAA96839 |
UniProt Accession (Sequence) | Q9LST4 |
Cultivar | Nipponbare ( GRIN , IRIS ) |
Term Type | Term | Reference | Evidence | |||
---|---|---|---|---|---|---|
Biological Process | ubiquitin-dependent protein catabolic process (GO:0006511) | Jaiswal-P et al., 2003 |
| |||
Cellular Component | proteasome core complex (GO:0005839) | Jaiswal-P et al., 2003 |
|
Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane   -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
Others : Fungi | Metazoa |
3D protein structures : BLink from NCBI |
Pfam (Info) | PF00227; proteasome | All Members of this Family | |
---|---|---|---|
Prosite (Info) | PS00854; PROTEASOME_B | Residues from 41: IALKYKDGVIMASDTGASYGSTLRYKSVERIKAVGKHSLIGASGEFSD All Members of this Family |
|
Physio-chemical features | Q9LST4 | ||
ProtoMap (Info) | Q9LST4_ORYSA |