![[Home Page]](/images/icons/gramene_logo180new.jpg "[Home Page]"){kind=icon}
Protein Home |
Advanced Search |
Search by Pfam or PROSITE |
Browse by GO Slim |
Documents |
Tutorial |
FAQ |
Help
Oryza sativa (japonica cultivar-group) protein "P14578" (Cytochrome c oxidase subunit 1) | Accession | P14578 |
|---|---|
| Species | Oryza sativa (japonica cultivar-group) [ GR_tax:013684 ] |
| Name | Cytochrome c oxidase subunit 1 |
| Symbol | COX1 |
| Synonyms (1) | COXI |
| E.C. Numbers (1) | 1.9.3.1 |
| Gene Names (1) | cox1 (Cytochrome c oxidase subunit 1) |
| Organelle | Mitochondrion |
| Best Hits To TIGR Rice Gene Models (0) | None [ Click here to generate a BLASTP query ] |
| IRGSP/RAP Genes (0) | None |
| Source | SWISSPROT |
| GenBank Accessions (1) | P14578 |
| UniProt Accession (Sequence) | P14578 |
| Cultivar | TAICHUNG 65 ( GRIN , IRIS ) |
| Comment | It encodes for the subunit I of cytochrome c oxidase enzyme, which is the terminal member of the mitochondrial inner membrane electron transport chain; one of three mitochondrially-encoded subunits. (Imported from Gene GR:0100129) |
Associated Ontologies (7) | Term Type | Term | Reference | Evidence | ||
|---|---|---|---|---|---|
| Molecular Function | cytochrome-c oxidase activity (GO:0004129) | Jaiswal-P et al., 2003 |
| ||
| Biological Process | electron transport chain (GO:0022900) | Jaiswal-P et al., 2003 |
| ||
| mitochondrial electron transport, cytochrome c to oxygen (GO:0006123) | Jaiswal-P et al., 2006 | IC | |||
| aerobic respiration (GO:0009060) | Jaiswal-P et al., 2006 | IC | |||
| Cellular Component | membrane (GO:0016020) | Jaiswal-P et al., 2004 | RCA | ||
| mitochondrion (GO:0005739) | Boeckmann-B et al., 2003 | IC | |||
| Suzuki-T et al., 1991 | ISS | ||||
| Kadowaki-K et al., 1989 | ISS | ||||
| mitochondrial respiratory chain complex IV (GO:0005751) | Jaiswal-P et al., 2003 |
|
Keywords (7) Similarity to Other Proteins (22) | Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
| Others : Fungi | Metazoa |
| 3D protein structures : BLink from NCBI |
Protein Features (17) | Pfam (Info) | PF00115; COX1 | All Members of this Family | |
|---|---|---|---|
| Prosite (Info) | PS00077; COX1 | Residues from 239: WFFGHPEVYILILPGFGIISHIVSTFSRKPVFGYLGMVYAMISIGVLGFLVWAHH All Members of this Family |
|
| PS50855; COX1 | Sequence info. not available All Members of this Family |
||
| Physio-chemical features | P14578 | ||
| ProtoMap (Info) | COX1_ORYSA | ||
| Feature Type | Residues (From - To) | Evidence | |
| Transmembrane | 16 - 38 | Jaiswal-P et al., 2004 | |
| Transmembrane | 60 - 82 | Jaiswal-P et al., 2004 | |
| Transmembrane | 103 - 125 | Jaiswal-P et al., 2004 | |
| Transmembrane | 145 - 167 | Jaiswal-P et al., 2004 | |
| Transmembrane | 187 - 209 | Jaiswal-P et al., 2004 | |
| Transmembrane | 239 - 261 | Jaiswal-P et al., 2004 | |
| Transmembrane | 268 - 290 | Jaiswal-P et al., 2004 | |
| Transmembrane | 305 - 327 | Jaiswal-P et al., 2004 | |
| Transmembrane | 340 - 362 | Jaiswal-P et al., 2004 | |
| Transmembrane | 377 - 399 | Jaiswal-P et al., 2004 | |
| Transmembrane | 411 - 433 | Jaiswal-P et al., 2004 | |
| Transmembrane | 448 - 467 | Jaiswal-P et al., 2004 | |
Database Cross-References (6) 
