Accession | O24217 |
---|---|
Species | Oryza sativa (indica cultivar-group) [ GR_tax:013682 ] |
Name | 1-aminocyclopropane-1-carboxylate synthase |
Symbol | OS-ACS2 |
Synonyms (0) | |
E.C. Numbers (0) | None |
Gene Names (1) | OS-ACS2 |
Organelle | Not available |
Best Hits To TIGR Rice Gene Models (0) | None [ Click here to generate a BLASTP query ] |
IRGSP/RAP Genes (1) | Os04g0578000 |
Source | TREMBL |
GenBank Accessions (1) | AAB06619.1 |
UniProt Accession (Sequence) | O24217 |
Cultivar | IR36 ( GRIN , IRIS ) |
Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane   -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
Others : Fungi | Metazoa |
3D protein structures : BLink from NCBI |
Pfam (Info) | Not available | ||
---|---|---|---|
Prosite (Info) | PS00430; TONB_DEPENDENT_REC_1 | Residues from 1: LSLDLIEEWSKNHPEASICTPEGVSQFKRIAN All Members of this Family |
|
Physio-chemical features | O24217 | ||
ProtoMap (Info) | O24217_ORYSA |