![[Home Page]](/images/icons/gramene_logo180new.jpg "[Home Page]"){kind=icon}
Markers Home |
Markers Search |
Browse Map Sets |
SSR Markers Resource |
Microarray Probes |
Help |
Tutorial |
FAQs
Zea mays Genomic DNA "X55308"
| ID | 27773 | ||||
|---|---|---|---|---|---|
| Name | X55308 (GenBank Locus Name) | ||||
| Synonyms (3) |
|
||||
GenBank Accession  | X55308 | ||||
| GenBank GI | 22581 | ||||
| GenBank Version | X55308.1 | ||||
| MaizeGDB DNA Probe | p-H2 | ||||
| Type | Genomic DNA | ||||
| Species | Zea mays (Maize) [ GR_tax:014450 ] | ||||
| Germplasm | |||||
| Description | Z.mays (R) Kn1-O allele. | ||||
| Tags () | None |
Source/Library
Details
| Marker Created: | |
|---|---|
| Marker Updated: | |
| Internal Marker Accession: | X55308 |
| Ec Number | |
| Allele | |
| Bound Moiety | |
| Cell Line | |
| Cell Type | |
| Chromosome | 1L |
| Citation | |
| Clone | |
| Clone Lib | |
| Codon Start | 1 |
| Comment | Related sequences X55306-X55308. |
| Compare | |
| Cons Splice | |
| Country | |
| Dev Stage | juvenile |
| Ecotype | |
| Evidence | |
| Exception | |
| Function | |
| Gene | Kn1 |
| Germline | |
| Haplotype | |
| Insertion Seq | |
| Isolate | |
| Isolation Source | |
| Keyword | Kn1-O allele |
| Lab Host | |
| Label | |
| Locus Tag | |
| Macronuclear | |
| Map | 128 centimorgans |
| Mod Base | |
| Mol Type | genomic DNA |
| Note | intron /exon boundary |
| Number | |
| Origin | |
| Patent | |
| Phenotype | |
| Plasmid | |
| Pop Variant | |
| Product | |
| Protein Id | CAA43605.1 |
| Pseudo | |
| Rearranged | |
| Ref Authors | Veit,B., Vollbrecht,E., Mathern,J. and Hake,S. |
| Ref Location | Genetics 125 (3), 623-631 (1990) |
| Ref Pubmed | 2165968 |
| Ref Title |
A tandem duplication causes the Kn1-O allele of Knotted, a dominant morphological mutant of maize |
| Ref Year | 1990 |
| Rpt Family | |
| Rpt Type | |
| Rpt Unit | |
| Sex | |
| Specimen Voucher | |
| Standard Name | |
| Sub Clone | |
| Sub Species | |
| Sub Strain | |
| Tissue Lib | |
| Tissue Type | |
| Transl Except | |
| Transl Table | |
| Translation |
MEEITQHFGVGASSHGHGHGQHHHHHHHHHPWASSLSAVVAPLPPQPPSAGLPLTLNTVAATGNSGGSGNPVLQLANGGG
|
| Transposon | |
| Variety |
Database Cross-References (4)
Sequences (1)
Genomic DNA Sequence (1)
CATGCGCTCACATCCTGGACATCTCAACTCATAAATGTATGTCAGTATAACTAAGTTAACATGATGCTTATGCCTTGCAT
GACATGTGATATGGATGAA
Map Positions (2)
| Map Type | Map Set | Name | Map | Position | Ext. Links | |||
|---|---|---|---|---|---|---|---|---|
| Genetic | BNL 1996 | BNL6.32 | 1 | 215.2-215.2 cM | View Comparative Map | |||
|
||||||||
| QTL | INRA Io/F2 Composite QTL 1996 | BNL6.32 | 1 | 242-242 cM | View Comparative Map | |||
|
||||||||
Associations (0)
Associated Ontologies (0)
Images (0)
