Accession | O64464 | ||
---|---|---|---|
Species | Oryza sativa (japonica cultivar-group) [ GR_tax:013684 ] | ||
Name | Proteasome subunit beta type 1 | ||
Symbol | PBF1 | ||
Synonyms (2) |
|
||
E.C. Numbers (1) | 3.4.25.1 | ||
Gene Names (1) | Pbf1 | ||
Organelle | Not available | ||
Best Hits To TIGR Rice Gene Models (0) | None [ Click here to generate a BLASTP query ] | ||
IRGSP/RAP Genes (0) | None | ||
Source | SWISSPROT | ||
GenBank Accessions (1) | BAA28276.1 | ||
UniProt Accession (Sequence) | O64464 | ||
Cultivar | Nipponbare ( GRIN , IRIS ) |
Term Type | Term | Reference | Evidence | |||
---|---|---|---|---|---|---|
Biological Process | ubiquitin-dependent protein catabolic process (GO:0006511) | Jaiswal-P et al., 2003 |
| |||
Cellular Component | proteasome core complex (GO:0005839) | Jaiswal-P et al., 2003 |
|
Viridiplantae Green plants -Embryophytes (plants) -Magnoliophytes (flowering plants) -Monocots | Grasses | Rice | Maize | Sorghum | Wheat | Barley | Rye | Oat | Sugarcane   -Dicots | Brassicaceae | Arabidopsis | Fabaceae (Legumes) | Solanaceae | Cucurbitaceae |
Others : Fungi | Metazoa |
3D protein structures : BLink from NCBI |
Pfam (Info) | PF00227; proteasome | All Members of this Family | |
---|---|---|---|
Prosite (Info) | PS00854; PROTEASOME_B | Residues from 17: VAIAGADYCVVAADTRLSVGYNILTRDHSKICELADKCALASSGFQGD All Members of this Family |
|
PS51476; PROTEASOME_B_2 | Sequence info. not available All Members of this Family |
||
Physio-chemical features | O64464 | ||
ProtoMap (Info) | PSB1_ORYSA |